For quotations, please use our online quotation form, and you may also contact us by
service@kendallscientific.com
+1-888.733.6849 (Toll-free)
+1-617.299.7367 (Int’l))
+1-888.733.6849
Our customer service representatives are available 24 hours, Monday through Friday to assist you.Introduction | TFPI2 takes part in the regulation of plasmin-mediated matrix remodeling. Inhibits trypsin, plasmin, factor VIIa/tissue factor and weakly factor Xa. TFPI2 doesn’t have any influence on thrombin. |
Synonyms | TFPI-2, REF1,Placental protein 52. |
Source | Nicotiana benthamiana |
Physical Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
Formulation | Lyophilized from a concentrated (1mg/ml) solution containing PBS pH-7.1. |
Solubility | It is recommended to reconstitute the lyophilized TFPI2 in sterile water & 50µg/ml BSA at a concentration of 1mg/ml, which can then be further diluted to other aqueous solutions. |
Stability | Lyophilized TFPI2 althoµgh stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TFPI2 Human should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. |
Amino Acid Sequence | HHHHHHGAAQEPTGNNAEICLLPLDYGPCKALLLRYYYDRYTQSCRQFLYGGCEGNANNFYTWEACDDACWRIEKVPKV. |
Purity | Greater than 97.0% as determined by SDS-PAGE. |
Biological Activity | The activity of the TFPI2 is expressed as the amount of trypsin inhibited per milligram of TFPI2. The ability to prevent the hydrolysis of benzoyl-Larginine ethyl ester hydrochloride by trypsin is measured by spectrophotometer. 1mg TFPI2 protein will inhibit 1-1.5 mg trypsin with activity of approximately 10,000 BAEE units per mg protein. |
Usage | NeoBiolabs products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drµgs, agricultural or pesticidal products, food additives or household chemicals. |
N/A
N/A