For quotations, please use our online quotation form, and you may also contact us by
service@kendallscientific.com
+1-888.733.6849 (Toll-free)
+1-617.299.7367 (Int’l))
+1-888.733.6849
Our customer service representatives are available 24 hours, Monday through Friday to assist you.Introduction | Spleen Tyrosine Kinase (SYK) belongs to the family of non-receptor type Tyr protein kinases. The SYK protein is extensively expressed in hematopoietic cells and is involved in coupling activated immunoreceptors to downstream signaling events which mediate diverse cellular responses, including proliferation, differentiation, and phagocytosis. SYK is considered to be a modulator of epithelial cell growth and a likely tumor suppressor in human breast carcinomas. SYK is a positive effector of BCR-stimulated responses. SYK connects the B-cell antigen receptor (BCR) to the utilization of calcium ion either throµgh a phosphoinositide 3-kinase-dependent pathway, when not phosphorylated on tyrosines of the linker region, or throµgh a phospholipase C-gamma-dependent pathway, when phosphorylated on Tyr-348 and Tyr-352. Therefore the differential phosphorylation of Syk can define the pathway by which BCR is coupled to the regulation of intracellular calcium ion (By similarity). SYK also phosphorylates USP25 and regulates its intracellular levels. |
Synonyms | Tyrosine-protein kinase SYK, Spleen tyrosine kinase, p72-Syk, SYK. |
Source | HEK 293 cells. |
Physical Appearance | Sterile filtered colorless solution. |
Formulation | SYK protein is supplied in 50mM Tris pH 7.5, 300mM NaCl and 10% Glycerol. |
Stability | Store at 4°C if entire vial will be used within 2-4 weeks.Store, frozen at -20°C for longer periods of time.Please avoid freeze thaw cycles. |
Amino Acid Sequence | MHHHHHHDYKDDDDKKLMASSGMADSANHLPFFFGNITREEAEDYLVQGGMSDGL YLLRQSRNYLGGFALSVAHGRKAHHYTIERELNGTYAIAGGRTHASPADLCHYHSQES DGLVCLLKKPFNRPQGVQPKTGPFEDLKENLIREYVKQTWNLQGQALEQAIISQKPQL EKLIATTAHEKMPWFHGKISREESEQIVLIGSKTNGKFLIRARDNNGSYALCLLHEGKV LHYRIDKDKTGKLSIPEGKKF |
Purity | Greater than 85.0% as determined by SDS-PAGE. |
Usage | NeoBiolab's products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drµgs, agricultural or pesticidal products, food additives or household chemicals. |
N/A
N/A