For quotations, please use our online quotation form, and you may also contact us by
service@kendallscientific.com
+1-888.733.6849 (Toll-free)
+1-617.299.7367 (Int’l))
+1-888.733.6849
Our customer service representatives are available 24 hours, Monday through Friday to assist you.Introduction | RORC is a DNA-binding transcription factor which belongs to the NR1 subfamily of nuclear hormone receptors. The specific functions of the RORC protein are not known; nevertheless, studies of a similar gene in mice have shown that the RORC gene may be vital for lymphoid organogenesis and may have an imperative regulatory role in thymopoiesis. Furthermore, studies in mice sµggest that RORC may inhibit the expression of Fas ligand and IL2. RORC may be a possible nuclear receptor for hydroxycholesterols, the binding of which strongly promotes coactivators recruitment. RORC is Crucial for thymopoiesis and the development of several secondary lymphoid tissues, including lymph nodes. RORC is also involved in lineage specification of uncommitted CD4(+) T helper cells into Th17 cells. In addition, RORCs regulate the expression of several components of the circadian clock. |
Synonyms | Nuclear receptor ROR-gamma, Nuclear receptor RZR-gamma, Nuclear receptor subfamily 1 group F member 3, Retinoid-related orphan receptor-gamma, RORC, NR1F3, RORG, RZRG, TOR, RZR-GAMMA. |
Source | Escherichia Coli. |
Physical Appearance | Sterile filtered colorless solution. |
Formulation | RORC protein is supplied in 50mM Tris, 150mM NaCl and 10% Glycerol, pH 7.5. |
Stability | Store at 4°C if entire vial will be used within 2-4 weeks.Store, frozen at -20°C for longer periods of time.Please avoid freeze thaw cycles. |
Amino Acid Sequence | MSYYHHHHHHDYDIPTTDYKDDDDKDYKDDDDKENLYFQGEFMRTQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQRCNAAYSCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQKQLQQRQQQQQEPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKASGSGPSYSNNLAKAGLNGASCHLEYSPERGKAEGRESFYSTGSQLTPDRCGLRFE |
Purity | Greater than 80.0% as determined by SDS-PAGE. |
Usage | NeoBiolab's products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drµgs, agricultural or pesticidal products, food additives or household chemicals. |
N/A
N/A