For quotations, please use our online quotation form, and you may also contact us by
service@kendallscientific.com
+1-888.733.6849 (Toll-free)
    +1-617.299.7367 (Int’l))
+1-888.733.6849
Our customer service representatives are available 24 hours, Monday through Friday to assist you.| Introduction | Chemokine (C-X-C motif) ligand 9 (CXCL9) is a small cytokine belonging to the CXC chemokine family that is also known as Monokine induced by gamma interferon (MIG). CXCL9 is a T-cell chemoattractant, which is induced by IFN-?. It is closely related to two other CXC chemokines called CXCL10 and CXCL11, whose genes are located near the gene for CXCL9 on human chromosome 4. CXCL9, CXCL10 and CXCL11 all elicit their chemotactic functions by interacting with the chemokine receptor CXCR3. | 
| Synonyms | Small inducible cytokine B9, CXCL9, Gamma interferon-induced monokine, MIG, chemokine (C-X-C motif) ligand 9, CMK, Humig, SCYB9, crg-10, monokine induced by gamma-interferon. | 
| Source | Escherichia Coli. | 
| Physical Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. | 
| Formulation | Lyophilized from a 0.2μm filtered concentrated (1.0mg/ml) solution in 20mM PB, pH 7.4, 50mM NaCl. | 
| Solubility | It is recommended to reconstitute the lyophilized MIG in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions. | 
| Stability | Lyophilized MIG althoµgh stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CXCL9 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. | 
| Amino Acid Sequence | TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT. | 
| Purity | Greater than 97.0% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. | 
| Biological Activity | Determined by its ability to chemoattract human peripheral blood T-Lymphocytes using a concentration range of 10-100ng/ml corresponding to a Specific Activity of 10,000-100,000IU/mg. | 
| Usage | NeoBiolab's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drµgs, agricultural or pesticidal products, food additives or household chemicals. | 
N/A
N/A