For quotations, please use our online quotation form, and you may also contact us by
service@kendallscientific.com
+1-888.733.6849 (Toll-free)
+1-617.299.7367 (Int’l))
+1-888.733.6849
Our customer service representatives are available 24 hours, Monday through Friday to assist you.Introduction | EBI3 has an induced expression in B lymphocytes in reaction to Epstein-Barr virus infection. EBI3 encodes a secreted glycoprotein belonging to the hematopoietin receptor family, and heterodimerizes with a 28 kDa protein to form iIL-27. EBI3 drives rapid clonal expansion of naive cd4(+) t-cells. EBI3 strongly synergizes with IL-12 to activate IFN-gamma production of naive cd4(+) t-cells. EBI3 mediates its biologic effects throµgh the cytokine receptor wsx-1/tccr. |
Synonyms | Interleukin-27 subunit beta, IL-27 subunit beta, IL-27B, Epstein-Barr virus-induced gene 3 protein, EBV-induced gene 3 protein, EBI3, IL27B. |
Source | Escherichia Coli. |
Physical Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
Formulation | EBI3 Human Recombinant was lyophilized from a solution containig 10mM Acetic Acid and 0.5% Mannitol. |
Solubility | It is recommended to reconstitute the lyophilized EBI3 in sterile 10mM Acetic acid not less than 100 |
Stability | Lyophilized EBI3 althoµgh stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution EBI3 should be stored at 4°C between 2-7 days and for future use below-18°C. Please prevent freeze-thaw cycles. |
Amino Acid Sequence | RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK. |
Purity | Greater than 90% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
Biological Activity | Assay data for Human recombinant EBI3 is based upon qualitative binding to anti-EBI3 antibody. |
Usage | NeoBiolab's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drµgs, agricultural or pesticidal products, food additives or household chemicals. |
N/A
N/A