For quotations, please use our online quotation form, and you may also contact us by
service@kendallscientific.com
+1-888.733.6849 (Toll-free)
+1-617.299.7367 (Int’l))
+1-888.733.6849
Our customer service representatives are available 24 hours, Monday through Friday to assist you.Introduction | Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thoµght to play a key role in cardiovascular homeostasis. Helps restore the body's salt and water balance. Improves heart function. |
Synonyms | NPPB, Natriuretic Peptide Precursor B, BNP, B-type Natriuretic Peptide. |
Source | NULL |
Physical Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
Formulation | The protein was lyophilized without additives. |
Solubility | It is recommended to reconstitute the lyophilized B-type Natriuretic Peptide in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
Stability | Lyophilized B-type Natriuretic Peptide althoµgh stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution B-type Natriuretic Peptide should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. |
Amino Acid Sequence | SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH. |
Purity | Greater than 95.0% as determined by RP-HPLC. |
Usage | NeoBiolab's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drµgs, agricultural or pesticidal products, food additives or household chemicals. |
N/A
N/A