For quotations, please use our online quotation form, and you may also contact us by
service@kendallscientific.com
+1-888.733.6849 (Toll-free)
+1-617.299.7367 (Int’l))
+1-888.733.6849
Our customer service representatives are available 24 hours, Monday through Friday to assist you.| Introduction | The adipose tissue exclusively expresses and secretes Adiponectin (Acrp30). Acrp30 is involved in various physiological processes such as energy homeostasis, insulin sensitivity, hormonal processes, fatty acid metabolism and obesity. Adiponectin circulates in the plasma. Decreased levels of Adiponectin are associated with insulin resistance and hyperinsulinemia, as seen in people with obesity insulin resistance, and diabetes type 2, whose plasma levels of adiponectin are reduced.The modular structure of Acrp30 is comprised of N-terminal collagenous domain followed by a C-terminal globular domain.Acrp30 also acts as a significant negative regulator in hematopoiesis and immune systems; it may be involved in ending inflammatory responses throµgh its inhibitory functions. Adiponectin inhibits endothelial NF-kappa-b signaling throµgh a cAMP-dependent pathway, it also inhibits TNF-alpha- induced expression of endothelial adhesion molecules. |
| Synonyms | Acrp30, AdipoQ, GBP-28, APM-1, ACDC. |
| Source | Escherichia Coli. |
| Physical Appearance | Sterile Filtered clear solution. |
| Formulation | Acrp30 is liquid 1mg/ml in PBS, pH 7.4 containing 1mM DTT. |
| Amino Acid Sequence | MGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN. |
| Purity | Acrp30 purity is greater than 90% as determined by SDS-PAGE. |
| Usage | NeoBiolab's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drµgs, agricultural or pesticidal products, food additives or household chemicals. |
| Storage | Store Acrp30 at -20°C. Can be stored at 4°C for a limited period of time of 7 days. |
N/A
N/A