Secreted Phospholipase A2

our services
our products
Quotations & Ordering:

For quotations, please use our online quotation form, and you may also contact us by

service@kendallscientific.com

Phone:

+1-888.733.6849 (Toll-free)
+1-617.299.7367 (Int’l))

Fax:

+1-888.733.6849

Our customer service representatives are available 24 hours, Monday through Friday to assist you.
Secreted Phospholipase A2 List
    Cat No.NameDescriptionSizeQtyPriceAction
    ENPS-336PLA2G10 HumanSecreted Phospholipase A2-X Human Recombinant is manufactured with N-terminal fusion HisTag. PLA2G10 His-Tagged Fusion Protein, is 15.5 kDa containing 123 amino acid residues of the human secreted phospholipase A2-X and 16 additional amino acid residues - HisTag (underlined).MRGSHHHHHHGMASHMGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQELLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD.$65Add to Cart
    ENPS-337PLA2G12 HumanSecreted Phospholipase A2-XII Human Recombiannt was produced with N-terminal His-Tag. PLA2G12 His-Tagged Fusion Protein is 20.6 kDa containing 167 amino acid residues of the human secreted phospholipase A2-XII and 16 additional amino acid residues – His-Tag (underlined).MRGSHHHHHHGMASHMQEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLLGGEDGLCQYKCSDGSKPFPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHYEEKTDL.$65Add to Cart
    ENPS-332PLA2G1B HumanSecreted Phospholipase A2-IB Human Recombinant is manufactured with N-terminal fusionf HisTag. PLA2G1B His-Tagged Fusion Protein is 16 kDa containing 126 amino acid residues of the human secreted phospholipase A2-IB and 16 additional amino acid residues - HisTag (underlined).MRGSHHHHHH GMASHMAVWQ FRKMIKCVIP GSDPFLEYNN YGCYCGLGGS GTPVDELDKC CQTHDNCYDQ AKKLDSCKFL LDNPYTHTYS YSCSGSAITC SSKNKECEAF ICNCDRNAAI CFSKAPYNKA HKNLDTKKYC QS.$65Add to Cart
    ENPS-297PLA2G2A HumanSecreted Phospholipase A2-IIA Human Recombinant is manufactured with N-terminal fusion of HisTag. PLA2G2A His-Tagged Fusion Protein is 15.8 kDa containing 124 amino acid residues of the human secreted phospholipase A2-IIA and 16 additional amino acid residues – HisTag.$65Add to Cart
    ENPS-333PLA2G2D HumanSecreted Phospholipase A2-IID Human Recombinant was produced with N-terminal His-Tag. PLA2G2D His-Tagged Fusion protein is 16.4 kDa containing 125 amino acid residues of the human secreted phospholipase A2-IID and 16 additional amino acid residues – His-Tag (underlined).MRGSHHHHHHGMASHMGILNLNKMVKQVTGKMPILSYWPYGCHCGLGGRGQPKDATDWCCQTHDCCYDHLKTQGCGIYKYYRYNFSQGNIHCSDKGSWCEQQLCACDKEVAFCLKRNLDTYQKRLRFYWRPHCRGQTPGC.$65Add to Cart
    ENPS-334PLA2G2E HumanSecreted Phospholipase A2-IIE Human Recombinant manufactured with N-terminal His-Tag. PLA2G2E His-Tagged Fusion Protein is 15.8 kDa protein containing 123 amino acid residues of the human secreted phospholipase A2-IIE and 16 additional amino acid residues – His-Tag (underlined).MRGSHHHHHHGMASHMNLVQFGVMIEKMTGKSALQYNDYGCYCGIGGSHWPVDQTDWCCHAHDCCYGRLEKLGCEPKLEKYLFSVSERGIFCAGRTTCQRLTCECDKRAALCFRRNLGTYNRKYAHYPNKLCTGPTPPC.$65Add to Cart
    ENPS-335PLA2G5 HumanSecreted Phospholipase A2-V Human Recombinant was produced with N-terminal His-Tag. PLA2G5 His-Tagged Fusion protein is 15.5 kDa containing 118 amino acid residues of the human secreted phospholipase A2-V and 16 additional amino acid residues – His-Tag (underlined).MRGSHHHHHH GMASHMGLLD LKSMIEKVTG KNALTNYGFY GCYCGWGGRG TPKDGTDWCC WAHDHCYGRLEEKGCNIRTQ SYKYRFAWGV VTCEPGPFCH VNLCACDRKL VYCLKRNLRS YNPQYQYFPN ILCS.$65Add to Cart
    ENPS-443PLA2G7 HumanPLA2G7 Human Recombinant produced in E.Coli is single, a non-glycosylated, Polypeptide chain containing 420 amino acids fragment (22-441) having a total molecular mass of 52.29kDa and fused with a 4.5kDa amino-terminal hexahistidine tag. The PLA2G7 is purified by proprietary chromatographic techniques.$65Add to Cart

      promotions

      Image

      Custom Monoclonal Antibody
      MassAb Technologies
      Image
      Free Trial Custom Polyclonal Antibody
      You will receive free purified antibodies for validation
      Image
      Custom Peptides Synthesis

      Start from $40/each

      new technologies

      Image
      Optimized for enhanced
      expression levels
      XPromoter 2.0
      Image
      E.coli/insect cells/293 & CHO

      3 in 1 expression system
      Image
      MassAb Technologies

      Cover All Epitopes