For quotations, please use our online quotation form, and you may also contact us by
service@kendallscientific.com
+1-888.733.6849 (Toll-free)
+1-617.299.7367 (Int’l))
+1-888.733.6849
Our customer service representatives are available 24 hours, Monday through Friday to assist you.Introduction | Caused by one of four closely related virus serotypes of the genus Flavivirus, family Flaviviridae, each serotype is sufficiently different that there is no cross-protection and epidemics caused by multiple serotypes (hyperendemicity) can occur. In cell culture experiments and mice Morpholino antisense oligos have shown specific activity against Dengue virus. |
Synonyms | NULL |
Source | NULL |
Formulation | 1x PBS pH 7.4. |
Amino Acid Sequence | VMCTGSFKLEKEVAETQHGTVLVQVKYEGTDAPCKIPFSTQDEKGVTQNGRLITANPIVTDKEKPVNIEAEPP FGESYIVVGAGEKALKLSWFKKGSV. |
Purity | Protein is >95% pure as determined by 12% PAGE (coomassie staining). |
Usage | NeoBiolab's products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drµgs, agricultural or pesticidal products, food additives or household chemicals. |
Applications | Each laboratory should determine an optimum working titer for use in its particular application. |
Storage | Dengue Envelope-ST1 D-III althoµgh stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles. |
N/A
N/A